missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212272

Invitrogen™ Human NPHP1 (aa 282-379) Control Fragment Recombinant Protein

Product Code. 30212272
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212272

Brand: Invitrogen™ RP96114

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61148 (PA5-61148. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Juvenile nephronophthisis type 1 is caused by mutations of NPHP1, the gene encoding for nephrocystin. Nephrocystin interacts with p130Cas (BCAR1), proline-rich tyrosine kinase-2 (PTK2B or Pyk2), and tensin in embryonic kidney and testis, indicating that these proteins participate in a common signaling pathway. Nephrocystin and p130Cas interact in mammalian cells and both proteins prominently localize at or near sites of cell-cell contact in polarized Madin-Darby canine kidney epithelial cells. Expression of nephrocystin results in phosphorylation of Pyk2 on Tyrosine 402 as well as activation of downstream mitogen-activated protein kinases, such as ERK1 and ERK2. Nephrocystin contains a src-homology 3 (SH3) domain, which is highly conserved throughout evolution.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15259
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4867
Name Human NPHP1 (aa 282-379) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias JBTS4; juvenile nephronophthisis 1 protein; nephrocystin 1; Nephrocystin1; nephrocystin-1; nephronophthisis 1 (juvenile); nephronophthisis 1 (juvenile) homolog; nephronophthisis 1 (juvenile) homolog (human); NPH1; NPHP1; SLSN1
Common Name NPHP1
Gene Symbol NPHP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TVEDTNGSETGFRAWNVQSRGRIFLVSKPVLQINTVDVLTTMGAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.