missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NPDC1 (aa 205-325) Control Fragment Recombinant Protein

Product Code. 30196577
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196577

Brand: Invitrogen™ RP89897

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82338 (PA5-82338. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The discovery of NPDC-1 (neuronal proliferation, differentiation and control protein 1) was the result of a study of genes that were preferentially expressed in immortalized neural precursor cell lines at the onset of contact inhibition of proliferation and subsequent differentiation. It was further found that transfection of transformed cells with NPDC-1 led to increased doubling times and suppression of many characteristics of transformation. NPDC-1 is differentially expressed in brain and lung and has been shown to interact directly with the transcription factor E2F-1 as well as D-type cyclins and cdk2. NPDC-1 has been identified as a modulator of transcriptiona levents mediated by retinoic acid and the protein level and activity of NPDC-1 have been shown to be regulated by phosphorylation mediated proteasomal degradation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQX5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56654
Name Human NPDC1 (aa 205-325) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI314472; CAB; CAB-; CAB1; CAB-1; DKFZP586J0523; Neural proliferation differentiation and control protein 1; neural proliferation differentiation control-1 protein; neural proliferation, differentiation and control 1; neural proliferation, differentiation and control gene 1; neural proliferation, differentiation and control, 1; NPDC1; NPDC-1; RP23-47P18.6
Common Name NPDC1
Gene Symbol NPDC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.