Invitrogen™ Human NPDC1 (aa 205-325) Control Fragment Recombinant Protein

Product Code. 30196577

Brand: Invitrogen™ RP89897

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82338 (PA5-82338. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The discovery of NPDC-1 (neuronal proliferation, differentiation and control protein 1) was the result of a study of genes that were preferentially expressed in immortalized neural precursor cell lines at the onset of contact inhibition of proliferation and subsequent differentiation. It was further found that transfection of transformed cells with NPDC-1 led to increased doubling times and suppression of many characteristics of transformation. NPDC-1 is differentially expressed in brain and lung and has been shown to interact directly with the transcription factor E2F-1 as well as D-type cyclins and cdk2. NPDC-1 has been identified as a modulator of transcriptiona levents mediated by retinoic acid and the protein level and activity of NPDC-1 have been shown to be regulated by phosphorylation mediated proteasomal degradation.

Specifications

• Accession Number: Q9NQX5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56654
• Name: Human NPDC1 (aa 205-325) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI314472; CAB; CAB-; CAB1; CAB-1; DKFZP586J0523; Neural proliferation differentiation and control protein 1; neural proliferation differentiation control-1 protein; neural proliferation, differentiation and control 1; neural proliferation, differentiation and control gene 1; neural proliferation, differentiation and control, 1; NPDC1; NPDC-1; RP23-47P18.6
• Common Name: NPDC1
• Gene Symbol: NPDC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining