missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NPAS2 (aa 339-455) Control Fragment Recombinant Protein

Product Code. 30212048
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212048

Brand: Invitrogen™ RP100745

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54053 (PA5-54053. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the basic helix-loop-helix-PER-ARNT-SIM (bHLH-PAS) family are transcription factors that contain a bHLH DNA binding domain located amino-terminal to a PAS domain. Neuronal PAS domain protein 2 (NPAS2, also designated PAS 4/MOP4) is a member of the bHLH-PAS family and the PAS superfamily. NPAS2, which maps to chromosome 2p11.2-2q13, is expressed primarily in the neurons during the first week of postnatal development. The pattern of NPAS2 expression temporally matches the development of learning and memory, and spatially matches the frontal association/limbic forebrain pathway. NPAS2 may serve a regulatory role in the development and maintenance of long-term memory, and may be required for the processing of complex sensory information. NPAS2 and MOP3 form a transcriptionally active heterodimer which binds to a CACGTGA-containing DNA element and drives transcription from a linked luciferase reporter gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99743
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4862
Name Human NPAS2 (aa 339-455) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Basic-helix-loop-helix-PAS protein MOP4; bHLHe9; Class E basic helix-loop-helix protein 9; member of PAS protein 4; member of PAS superfamily 4; MOP4; neuronal PAS domain protein 2; neuronal PAS domain-containing protein 2; Neuronal PAS2; NPAS2; PAS domain-containing protein 4; PASD4
Common Name NPAS2
Gene Symbol Npas2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SKPEFIVCTHSVVSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQELPVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.