Invitrogen™ Human NOVA1 (aa 328-455) Control Fragment Recombinant Protein

Product Code. 30197558

Brand: Invitrogen™ RP89051

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52063 (PA5-52063. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described.

Specifications

• Accession Number: P51513
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4857
• Name: Human NOVA1 (aa 328-455) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9430099M15Rik; G630039L02; neuro-oncological ventral antigen 1; NOVA alternative splicing regulator 1; Nova1; Nova-1; Onconeural ventral antigen 1; paraneoplastic Ri antigen; RNA-binding protein Nova-1; ventral neuron-specific protein 1
• Common Name: NOVA1
• Gene Symbol: NOVA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining