Invitrogen™ Human NOV (aa 150-243) Control Fragment Recombinant Protein

Product Code. 30200729

Brand: Invitrogen™ RP108154

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110839 (PA5-110839. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOV is a member of the CCN family of secreted, cysteine-rich regulatory proteins. The full-length NOV protein contains four structural domains that confer distinct, and sometimes opposing, biological activities. Elevated expression of NOV is associated with certain tumors, including Wilm's tumor and most nephroblastomas. However, in other tumor types and certain cancer cell lines, increased tumorigenicity and proliferation is correlated with decreased NOV expression. Additionally, NOV induces cell adhesion and cell migration by signaling through specific cell-surface integrins, and by binding to heparin sulfate proteoglycans and to fibulin 1C. NOV has also been reported to exert proangiogenic activities.

Specifications

• Accession Number: P48745
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4856
• Name: Human NOV (aa 150-243) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C130088N23Rik; CCN family member 3; CCN3; Cellular communication network factor 3; IBP-9; IGF-binding protein 9; IGFBP9; IGFBP-9; Insulin-like growth factor-binding protein 9; Nephro blastoma-overexpressed gene protein homolog; nephroblastoma overexpressed; nephroblastoma overexpressed gene; nephroblastoma overexpressed gene protein homolog; nephroblastoma-overexpressed gene protein homolog; NOV; NovH; protein NOV homolog
• Common Name: NOV
• Gene Symbol: CCN3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining