Invitrogen™ Human NOTCH3 (aa 1699-1766) Control Fragment Recombinant Protein

Product Code. 30198434

Brand: Invitrogen™ RP109835

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOTCH3 is the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction (with its cell-bound ligands delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human. NOTCH3 functions as a receptor for membrane-bound ligands Jagged1, Jagged2, and Delta1 to regulate cell-fate determination. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).

Specifications

• Accession Number: Q9UM47
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4854
• Name: Human NOTCH3 (aa 1699-1766) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW229011; CADASIL; CADASIL1; CASIL; hpbk; IMF2; LMNS; N3; Neurogenic locus notch homolog protein 3; notch 3; Notch 3 extracellular truncation; Notch 3 intracellular domain; Notch gene homolog 3; Notch homolog 3; NOTCH3
• Common Name: NOTCH3
• Gene Symbol: Notch3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVAADIRVAPAM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining