Invitrogen™ Human NOS1AP (aa 250-354) Control Fragment Recombinant Protein

Product Code. 30199590

Brand: Invitrogen™ RP102562

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56330 (PA5-56330. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms.

Especificaciones

• Accession Number: O75052
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9722
• Name: Human NOS1AP (aa 250-354) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330408P19Rik; Capon; carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein; C-terminal PDZ domain ligand of neuronal nitric oxide synthase; C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON); C-terminal PDZ ligand of neuronal nitric oxide synthase protein; Kiaa0464; ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain; MGC138500; nitric oxide synthase 1 (neuronal) adaptor protein; nitric oxide synthase 1 adaptor protein; NOS1AP
• Common Name: NOS1AP
• Gene Symbol: NOS1AP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining