missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NOS1AP (aa 149-230) Control Fragment Recombinant Protein

Product Code. 30208281
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208281

Brand: Invitrogen™ RP103220

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63147 (PA5-63147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75052
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9722
Name Human NOS1AP (aa 149-230) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330408P19Rik; Capon; carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein; C-terminal PDZ domain ligand of neuronal nitric oxide synthase; C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON); C-terminal PDZ ligand of neuronal nitric oxide synthase protein; Kiaa0464; ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain; MGC138500; nitric oxide synthase 1 (neuronal) adaptor protein; nitric oxide synthase 1 adaptor protein; NOS1AP
Common Name NOS1AP
Gene Symbol NOS1AP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.