Invitrogen™ Human NORE1 (aa 174-236) Control Fragment Recombinant Protein

Product Code. 30201552

Brand: Invitrogen™ RP105504

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84841 (PA5-84841. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q8WWW0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83593
• Name: Human NORE1 (aa 174-236) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300019G20Rik; AU042887; Maxp1; MGC10823; MGC17344; new ras effector 1; NORE1; Nore1A; NORE1B; novel ras effector 1; protein interacting with guanine nucleotide exchange factor; Rap1-binding protein; RAPL; Ras association (RalGDS/AF-6) domain family 5; Ras association (RalGDS/AF-6) domain family member 5; Ras association domain family member 5; ras association domain-containing protein 5; Ras effector-like protein; RASSF3; RASSF5; regulator for cell adhesion and polarization enriched in lymphoid tissue; regulator for cell adhesion and polarization enriched in lymphoid tissues; RP11-343H5.1; tumor; tumor suppressor RASSF3
• Common Name: NORE1
• Gene Symbol: RASSF5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining