Invitrogen™ Human NOP58 (aa 172-306) Control Fragment Recombinant Protein

Product Code. 30193905

Brand: Invitrogen™ RP91831

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54321 (PA5-54321. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nop5p, or Nop58p, is localized in the nucleolus and required for pre-18S rRNA processing in Saccharomyces cerevisiae.

Specifications

• Accession Number: Q9Y2X3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51602
• Name: Human NOP58 (aa 172-306) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: HSPC120; MSSP; Nap65; Nol5; NOP5; NOP5/NOP58; Nop58; NOP58 ribonucleoprotein; NOP58 ribonucleoprotein homolog; Nopp140 associated protein; nopp140-associated protein of 65 kDa; Nucleolar protein 5; nucleolar protein 58; nucleolar protein NOP5/NOP58; nucleolar protein NOP58; O6108; RNA-processing protein NOP58; SIK; SIK similar protein; SIK-similar protein; YOR310C
• Common Name: NOP58
• Gene Symbol: NOP58
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIAHAGSLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining