Invitrogen™ Human NOP14 (aa 732-825) Control Fragment Recombinant Protein

Product Code. 30194499

Brand: Invitrogen™ RP106654

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65964 (PA5-65964. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm.

Specifications

• Accession Number: P78316
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8602
• Name: Human NOP14 (aa 732-825) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610033H07Rik; C4orf9; NOL14; NOP14; NOP14 nucleolar protein; NOP14 nucleolar protein homolog; nucleolar complex protein 14; Nucleolar protein 14; probable nucleolar complex protein 14; RES425; RES4-25; RGD1305605; UTP2
• Common Name: NOP14
• Gene Symbol: NOP14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLARMQLSEIMER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining