missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NONO (aa 353-426) Control Fragment Recombinant Protein

Product Code. 30210516
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210516

Brand: Invitrogen™ RP103174

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84183 (PA5-84183. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15233
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4841
Name Human NONO (aa 353-426) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; AA407051; AV149256; DNA-binding p52/p100 complex, 52 kDa subunit; HGNC:7871; LOC100346936; MRXS34; NMT-1; NMT55; nonA; Nono; NonO protein; non-POU domain containing octamer binding; non-POU domain containing, octamer-binding; non-POU domain-containing octamer (ATGCAAAT) binding protein; non-POU domain-containing octamer-binding protein; non-POU-domain-containing; non-POU-domain-containing, octamer binding protein; non-POU-domain-containing, octamer-binding protein; NRB54; P54; p54(nrb); p54nrb; PPP1R114; protein phosphatase 1, regulatory subunit 114
Common Name NONO
Gene Symbol Nono
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.