Invitrogen™ Human NOL6 (aa 1042-1146) Control Fragment Recombinant Protein

Product Code. 30203301

Brand: Invitrogen™ RP93046

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63202 (PA5-63202. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified.

Specifications

• Accession Number: Q9H6R4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65083
• Name: Human NOL6 (aa 1042-1146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA410091; bA311H10.1; LOW QUALITY PROTEIN: nucleolar protein 6; Nol6; Nrap; nucleolar protein 6; nucleolar protein 6 (RNA-associated); nucleolar protein family 6; nucleolar protein family 6 (RNA-associated); nucleolar RNA-associated protein; UTP22
• Common Name: NOL6
• Gene Symbol: NOL6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining