missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201069

Invitrogen™ Human NOD4 (aa 1688-1783) Control Fragment Recombinant Protein

Product Code. 30201069
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201069

Brand: Invitrogen™ RP107006

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66325 (PA5-66325. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOD4 is a member of the NOD (nucleotide-binding oligomerization domain) family, a group of proteins that are involved in innate immune defense. NOD4 contains a CARD-like domain, a central NOD domain and a large LRR region. NOD4, an IFN-gamma-inducible nuclear protein, plays a role in homeostatic control of innate immunity and in antiviral defense mechanisms. As a key negative regulator of NF-kappa-B and type I interferon signaling, NOD4 may be a useful target for manipulating immune responses against infectious or inflammation-associated diseases, including cancer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86WI3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84166
Name Human NOD4 (aa 1688-1783) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI451557; AK220210; Caterpiller protein 16.1; CLR16.1; copine II; Cpne2; NLR family CARD domain containing 5; NLR family, CARD domain containing 5; Nlrc5; NOD27; NOD4; NOD-like receptor C5; Nucleotide-binding oligomerization domain protein 27; Nucleotide-binding oligomerization domain protein 4; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 5; nucleotide-binding oligomerization domains 27; protein NLRC5
Common Name NOD4
Gene Symbol NLRC5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELPLLRQIDLVSCKIDNQTAKLLTSSFTSCPALEVILLSWNLLGDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.