Invitrogen™ Human NOD1 (aa 678-750) Control Fragment Recombinant Protein

Product Code. 30206725

Brand: Invitrogen™ RP107991

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOD1 is a member of the NOD (nucleotide-binding oligomerization domain) family, a group of proteins that are involved in innate immune defense. NOD1 contains an N-terminal caspase recruitment domain (CARD), a centrally located nucleotide-binding domain (NBD), and ten tandem leucine-rich repeats (LRRs) in its C-terminus. The CARD is involved in apoptotic signaling, and NOD1 activates caspase-9 and NF-kappa-B. LRRs participate in protein-protein interactions, and mutations in the NBD may affect the process of oligomerization and subsequent function of the LRR domain. This protein is an intracellular pattern-recognition receptor (PRR) that initiates inflammation in response to a subset of bacteria through the detection of bacterial diaminopimelic acid.

Specifications

• Accession Number: Q9Y239
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10392
• Name: Human NOD1 (aa 678-750) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C230079P11; Card4; caspase recruitment domain 4; caspase recruitment domain family, member 4; caspase recruitment domain-containing protein 4; CLR7.1; F830007N14Rik; NLR family, CARD domain containing 1; Nlrc1; Nod1; nucleotide binding oligomerization domain containing 1; nucleotide-binding oligomerization domain containing 1; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 1; nucleotide-binding oligomerization domain-containing protein 1; RGD1562269
• Common Name: NOD1
• Gene Symbol: NOD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining