missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NOC3L (aa 719-787) Control Fragment Recombinant Protein

Product Code. 30196631
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196631

Brand: Invitrogen™ RP107785

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67137 (PA5-67137. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GADD 153, a growth arrest and DNA damage-inducible gene, encodes a C/EBP-related nuclear protein. This protein has also been designated C/EBP-homologous protein (CHOP-10 or C/EBP zeta). GADD 153 expression is induced by a variety of cellular stresses, inducing nutrient deprivation and metabolic perturbations. GADD 153 functions to block cells in G1 to S phase during cell cycle progression and acts by dimerizing with other C/EBP proteins to direct GADD 153 dimers away from 'classical' C/EBP binding sites, recognizing instead unique 'nonclassical' sites. Thus, GADD 153 acts as a negative modulator of C/EBP-like proteins in certain terminally differentiated cells. GADD 153 belongs to the CBF/MAK21 family, which also includes NOC2L, NOC3L and NOC4L. NOC3L, also designated factor for adipocyte differentiation 24 or Fad24, promotes adipogenesis by controlling DNA replication during the early stages of mitotic clonal expansion (MCE).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WTT2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64318
Name Human NOC3L (aa 719-787) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AD24; AF233884; C10orf117; factor for adipocyte differentiation 24; Fad24; NOC3 like DNA replication regulator; NOC3 protein homolog; NOC3L; NOC3L DNA replication regulator; NOC3-like DNA replication regulator; NOC3-like protein; nucleolar complex associated 3 homolog; nucleolar complex associated 3 homolog (S. cerevisiae); nucleolar complex protein 3 homolog; Nucleolar complex-associated protein 3-like protein; RGD1560656
Common Name NOC3L
Gene Symbol NOC3L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATES
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.