Invitrogen™ Human NOC3L (aa 719-787) Control Fragment Recombinant Protein

Product Code. 30196631

Brand: Invitrogen™ RP107785

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67137 (PA5-67137. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GADD 153, a growth arrest and DNA damage-inducible gene, encodes a C/EBP-related nuclear protein. This protein has also been designated C/EBP-homologous protein (CHOP-10 or C/EBP zeta). GADD 153 expression is induced by a variety of cellular stresses, inducing nutrient deprivation and metabolic perturbations. GADD 153 functions to block cells in G1 to S phase during cell cycle progression and acts by dimerizing with other C/EBP proteins to direct GADD 153 dimers away from 'classical' C/EBP binding sites, recognizing instead unique 'nonclassical' sites. Thus, GADD 153 acts as a negative modulator of C/EBP-like proteins in certain terminally differentiated cells. GADD 153 belongs to the CBF/MAK21 family, which also includes NOC2L, NOC3L and NOC4L. NOC3L, also designated factor for adipocyte differentiation 24 or Fad24, promotes adipogenesis by controlling DNA replication during the early stages of mitotic clonal expansion (MCE).

Specifications

• Accession Number: Q8WTT2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64318
• Name: Human NOC3L (aa 719-787) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AD24; AF233884; C10orf117; factor for adipocyte differentiation 24; Fad24; NOC3 like DNA replication regulator; NOC3 protein homolog; NOC3L; NOC3L DNA replication regulator; NOC3-like DNA replication regulator; NOC3-like protein; nucleolar complex associated 3 homolog; nucleolar complex associated 3 homolog (S. cerevisiae); nucleolar complex protein 3 homolog; Nucleolar complex-associated protein 3-like protein; RGD1560656
• Common Name: NOC3L
• Gene Symbol: NOC3L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining