missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NOC2L (aa 573-673) Control Fragment Recombinant Protein

Product Code. 30207020
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207020

Brand: Invitrogen™ RP107141

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

INHAT (inhibitor of acetyltransferases) complex binds to histones and masks them from being substrate for acetyltransferase. Endogenous INHAT subunits, which include the Set/TAF-Ibeta oncoprotein, associate with chromatin in vivo and can block coactivator mediated transcription when transfected in cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y3T9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26155
Name Human NOC2L (aa 573-673) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA410003; AF155546; DKFZp564C186; FLJ35172; hypothetical protein LOC508638; NET15; NET7; NIR; NOC2 like nucleolar associated transcriptional repressor; NOC2L; NOC2L nucleolar associated transcriptional repressor; NOC2-like; NOC2-like nucleolar associated transcriptional repressor; NOC2-like protein; novel INHAT (inhibitor of histone acetyltransferase) repressor; novel INHAT repressor; nucleolar complex associated 2 homolog; nucleolar complex associated 2 homolog (S. cerevisiae); nucleolar complex protein 2 homolog; PPP1R112; Protein NOC2 homolog; protein phosphatase 1, regulatory subunit 12; RGD1309387
Common Name NOC2L
Gene Symbol NOC2L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.