Invitrogen™ Human NNT (aa 2-150) Control Fragment Recombinant Protein

Product Code. 30208374

Brand: Invitrogen™ RP102401

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52118 (PA5-52118. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification.

Specifications

• Accession Number: Q13423
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23530
• Name: Human NNT (aa 2-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930423F13Rik; AI323702; BB168308; GCCD4; NAD(P) transhydrogenase, mitochondrial; nicotinamide nucleotide transhydrogenase; Nicotinamide nucleotide transhydrogenase (NAD(P)+ transhydrogenase); NNT; Pyridine nucleotide transhydrogenase; pyridine nucleotide transhydrogenase precursor (EC 1.6.1.1)
• Common Name: NNT
• Gene Symbol: NNT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining