Invitrogen™ Human NMNAT3 (aa 80-165) Control Fragment Recombinant Protein

Product Code. 30195236

Brand: Invitrogen™ RP96415

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63436 (PA5-63436. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Can also use GTP and ITP as nucleotide donors. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, can use NAD (+), NADH, NAAD, nicotinic acid adenine dinucleotide phosphate (NHD), nicotinamide guanine dinucleotide (NGD) as substrates. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NAADP(+). Protects against axonal degeneration following injury.

Specifications

• Accession Number: Q96T66
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 349565
• Name: Human NMNAT3 (aa 80-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933408N02Rik; FKSG76; naMN adenylyltransferase 1; naMN adenylyltransferase 3; nicotinamide mononucleotide adenylyltransferase 3; nicotinamide nucleotide adenylyltransferase 3; Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3; nicotinamide-nucleotide adenylyltransferase 3; nicotinate-nucleotide adenylyltransferase 1; nicotinate-nucleotide adenylyltransferase 3; NMN adenylyltransferase 3; NMN/NaMN adenylyltransferase 3; NMNAT3; PNAT3; PNAT-3; pyridine nucleotide adenylyltransferase 3
• Common Name: NMNAT3
• Gene Symbol: NMNAT3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining