missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199985

Invitrogen™ Human NME5 (aa 141-207) Control Fragment Recombinant Protein

Product Code. 30199985
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199985

Brand: Invitrogen™ RP96871

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65153 (PA5-65153, PA5-60746 (PA5-60746. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P56597
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8382
Name Human NME5 (aa 141-207) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700019D05Rik; expressed in non-metastatic cells 5; inhibitor of p53-induced apoptosis-beta; IPIA-beta; NDK-H 5; NDP kinase homolog 5; NM23H5; NM23-H5; nm23-M5; NME/NM23 family member 5; NME5; non-metastatic cells 5 protein expressed in; non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase homolog 5; radial spoke 23 homolog; RSPH23; testis-specific nm23 homolog
Common Name NME5
Gene Symbol NME5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.