missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201072

Invitrogen™ Human NLRC4 (aa 756-889) Control Fragment Recombinant Protein

Product Code. 30201072
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201072

Brand: Invitrogen™ RP89236

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NLRC4 encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NPP4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 58484
Name Human NLRC4 (aa 756-889) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9530011P19Rik; AIFEC; CARD, LRR, and NACHT-containing protein; Card12; caspase recruitment domain family, member 12; caspase recruitment domain-containing protein 12; CLAN; Clan protein; CLAN1; CLANA; CLANB; CLANC; CLAND; CLR2.1; FCAS4; ice protease-activating factor; ICE-protease activating factor; ipaf; NLR family CARD domain containing 4; NLR family CARD domain-containing protein 4; NLR family, CARD domain containing 4; NLRC4; NOD-like receptor C4; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 4; UNQ6189/PRO20215
Common Name NLRC4
Gene Symbol Nlrc4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TDSLGNLKNLTKLIMDNIKMNEEDAIKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKILAQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.