Invitrogen™ Human Nkx2.3 (aa 62-146) Control Fragment Recombinant Protein

Code produit. 30182559

Marque: Invitrogen™ RP98403

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61547 (PA5-61547. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NKX2-3 encodes a homeodomain-containing transcription factor. The encoded protein is a member of the NKX family of homeodomain transcription factors. Studies of similar proteins in mouse and rat have indicated a potential role in cellular differentiation.

Spécification

• Accession Number: Q8TAU0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 159296
• Name: Human Nkx2.3 (aa 62-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CS x 3; Drosophila NK2 transcription factor related, locus 3; homeobox protein NK-2 homolog 3; Homeobox protein NK-2 homolog C; homeobox protein Nkx-2.3; homeobox protein Nkx-2.3; LOW QUALITY PROTEIN: homeobox protein Nkx-2.3; hypothetical protein LOC539451; NK2 homeobox 3; NK2 transcription factor related, locus 3; NK2.3; NK x 2.3; Nkx-2.3; NK x 23; NK x 2-3; NK x 2 C; Nk x 2-C; NK x 4-3; tinman
• Common Name: Nkx2.3
• Gene Symbol: NKX2-3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining