Invitrogen™ Human NIPBL (aa 1289-1376) Control Fragment Recombinant Protein

Product Code. 30203262

Brand: Invitrogen™ RP96947

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59316 (PA5-59316. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probably plays a structural role in chromatin. Involved in sister chromatid cohesion, possibly by interacting with the cohesin complex.

Specifications

• Accession Number: Q6KC79
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25836
• Name: Human NIPBL (aa 1289-1376) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CDLS; CDLS1; delangin; Delangin homolog; DKFZp434L1319; FLJ11203; FLJ12597; FLJ13354; FLJ13648; Idn3; IDN3-B; NIPBL; NIPBL, cohesin loading factor; Nipped-B homolog; Nipped-B homolog (Drosophila); nipped-B-like protein; SCC2; SCC2 homolog; sister chromatid cohesion 2 homolog
• Common Name: Delangin
• Gene Symbol: NIPBL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining