missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206890

Invitrogen™ Human NIPA (aa 5-108) Control Fragment Recombinant Protein

Product Code. 30206890
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206890

Brand: Invitrogen™ RP92632

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82664 (PA5-82664. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an F-box-containing protein that is a component of an SCF-type E3 ubiquitin ligase complex that regulates the onset of cell division. The G2/M transition in the cell cycle requires the interaction of the proteins cyclin B1 and cyclin-dependent kinase 1. The activated ubiquitin ligase complex targets the protein cyclin B1 for degradation, preventing this transition to mitosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86WB0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51530
Name Human NIPA (aa 5-108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110054L24Rik; AU018540; AU019789; C3HC type 1; hematopoietic stem/progenitor cell protein 216; hNIPA; HSPC216; mNIPA; Nipa; nuclear interacting partner of ALK; nuclear interacting partner of anaplastic lymphoma kinase (Alk); nuclear-interacting partner of ALK; Nuclear-interacting partner of anaplastic lymphoma kinase; OTTHUMP00000212330; RGD1561099; ZC3HC1; zinc finger C3HC-type containing 1; zinc finger C3HC-type protein 1; zinc finger, C3HC type 1; zinc finger, C3HC-type 1; zinc finger, C3HC-type containing 1
Common Name NIPA
Gene Symbol ZC3HC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.