missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206890

Invitrogen™ Human NIPA (aa 5-108) Control Fragment Recombinant Protein

Product Code. 30206890
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206890 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206890 Supplier Invitrogen™ Supplier No. RP92632

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82664 (PA5-82664. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an F-box-containing protein that is a component of an SCF-type E3 ubiquitin ligase complex that regulates the onset of cell division. The G2/M transition in the cell cycle requires the interaction of the proteins cyclin B1 and cyclin-dependent kinase 1. The activated ubiquitin ligase complex targets the protein cyclin B1 for degradation, preventing this transition to mitosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86WB0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51530
Name Human NIPA (aa 5-108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110054L24Rik; AU018540; AU019789; C3HC type 1; hematopoietic stem/progenitor cell protein 216; hNIPA; HSPC216; mNIPA; Nipa; nuclear interacting partner of ALK; nuclear interacting partner of anaplastic lymphoma kinase (Alk); nuclear-interacting partner of ALK; Nuclear-interacting partner of anaplastic lymphoma kinase; OTTHUMP00000212330; RGD1561099; ZC3HC1; zinc finger C3HC-type containing 1; zinc finger C3HC-type protein 1; zinc finger, C3HC type 1; zinc finger, C3HC-type 1; zinc finger, C3HC-type containing 1
Common Name NIPA
Gene Symbol ZC3HC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.