missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196582

Invitrogen™ Human NIP30 (aa 169-223) Control Fragment Recombinant Protein

Product Code. 30196582
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196582

Brand: Invitrogen™ RP106956

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84428 (PA5-84428. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM192A is also known as Nip30. This protein has not bee characterized.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9GZU8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80011
Name Human NIP30 (aa 169-223) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700001O11Rik; 2310065K24Rik; AI596259; C16orf94; CDA018; CDA10; Fam192a; family with sequence similarity 192 member A; family with sequence similarity 192, member A; NEFA-interacting nuclear protein NIP30; Nip30; PA28G-interacting protein; PIP30; protein FAM192A; PSME3-interacting protein; RGD1307433
Common Name NIP30
Gene Symbol FAM192A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.