Invitrogen™ Human Ninein (aa 530-665) Control Fragment Recombinant Protein

Product Code. 30210717

Brand: Invitrogen™ RP102160

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82224 (PA5-82224. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ninein is a component of subdistal appendages of the mother centriole, localized specifically in the pericentriolar matrix of the centrosome. It may be involved in microtubule minus-end capping, centriole positioning, and protein anchoring. Recent studies have shown that the microtubule nucleation and anchoring at the centrosome are independent processes linked by ninein function. At least five human ninein isoforms with divergent C-terminal domains and two mouse isoforms have been reported. Data indicates that the combined action of domains (C-terminal and N-terminal) might, in the absence of coiled coil region, be sufficient to localize ninein to the mother centriole. Microinjection of antibodies against ninein into metaphase HeLa cells can disrupt the reformation of tubular conformation of proteins within the centrosome following cell division, and consequently lead to dispersal of centrosomal material throughout the cytosol. MTOC (microtubule organizing center) function can be disrupted when anti-ninein antibodies are injected into postmitotic cells. Antibodies against ninein are present in sera from patients with autoimmune diseases that develop autoantibodies to centrosomal proteins.

Specifications

• Accession Number: Q8N4C6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51199
• Name: Human Ninein (aa 530-665) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110068G20Rik; AI385615; AU024711; glycogen synthase kinase 3 beta-interacting protein; GSK3B-interacting protein; hNinein; KIAA1565; mKIAA1565; Nin; Ninein; ninein (GSK3B interacting protein); ninein centrosomal protein; SCKL7
• Common Name: Ninein
• Gene Symbol: NIN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining