Invitrogen™ Human NIM1 (aa 22-143) Control Fragment Recombinant Protein

Product Code. 30193704

Brand: Invitrogen™ RP89814

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52467 (PA5-52467. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NIM1K serine/threonine kinase or NIM1 belongs to CAMK kinase family. Unlike to other AMPK-related kinases, NIM1 cannot be phosphorylated and activated by LKB1. Two somatic mutations (P333S and P411T) were found in lung neuroendocrine carcinoma and lung large cell carcinoma samples. NIM1 gene ontology (GO) annotations include cellular response to glucose starvation; intracellular signal transduction; negative regulation of TOR signaling; protein phosphorylation.

Specifications

• Accession Number: Q8IY84
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 167359
• Name: Human NIM1 (aa 22-143) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: E130304F04Rik; Nim1; NIM1 serine/threonine protein kinase; NIM1 serine/threonine-protein kinase; NIM1K; Serine/threonine-protein kinase NIM1
• Common Name: NIM1
• Gene Symbol: NIM1K
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEKVVREITLGKRIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIIRLYEVVETL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining