missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NIM1 (aa 22-143) Control Fragment Recombinant Protein

Product Code. 30193704
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193704

Brand: Invitrogen™ RP89814

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52467 (PA5-52467. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NIM1K serine/threonine kinase or NIM1 belongs to CAMK kinase family. Unlike to other AMPK-related kinases, NIM1 cannot be phosphorylated and activated by LKB1. Two somatic mutations (P333S and P411T) were found in lung neuroendocrine carcinoma and lung large cell carcinoma samples. NIM1 gene ontology (GO) annotations include cellular response to glucose starvation; intracellular signal transduction; negative regulation of TOR signaling; protein phosphorylation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IY84
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 167359
Name Human NIM1 (aa 22-143) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias E130304F04Rik; Nim1; NIM1 serine/threonine protein kinase; NIM1 serine/threonine-protein kinase; NIM1K; Serine/threonine-protein kinase NIM1
Common Name NIM1
Gene Symbol NIM1K
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEKVVREITLGKRIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIIRLYEVVETL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.