Invitrogen™ Human Niban-like protein (aa 134-233) Control Fragment Recombinant Protein

Product Code. 30200566

Brand: Invitrogen™ RP92964

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54403 (PA5-54403. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM129B (Family With Sequence Similarity 129 Member B, Niban Like Protein 1) is a Protein Coding gene. May play a role in apoptosis suppression. May promote melanoma cell invasion in vitro. Among its related pathways are MAP Kinase Signaling. An important paralog of this gene is FAM129A.

Specifications

• Accession Number: Q96TA1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64855
• Name: Human Niban-like protein (aa 134-233) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9130404D14Rik; bA356B19.6; C9orf88; FAM129B; family with sequence similarity 129 member B; family with sequence similarity 129, member B; Meg-3; Melanoma invasion by ERK; MINERVA; NIBAN2; Niban-like protein 1; OC58; Protein FAM129B; Protein Niban 2; RGD1307018
• Common Name: Niban-like protein
• Gene Symbol: Fam129b
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining