Invitrogen™ Human NHP2 (aa 81-150) Control Fragment Recombinant Protein

Product Code. 30210446

Brand: Invitrogen™ RP100661

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60638 (PA5-60638. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NHP2 belongs to the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. It is required for ribosome biogenesis and telomere maintenance, and for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.

Specifications

• Accession Number: Q9NX24
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55651
• Name: Human NHP2 (aa 81-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410130M07Rik; D11Ertd175e; DKCB2; H/ACA ribonucleoprotein complex subunit 2; H/ACA small nucleolar RNPs; HSPC286; Nhp2; NHP2 ribonucleoprotein; NHP2 ribonucleoprotein homolog; NHP2-like protein; NHP2P; NOLA2; Nucleolar protein family A member 2; nucleolar protein family A, member 2; nucleolar protein family A, member 2 (H/ACA small nucleolar RNPs); snoRNP protein NHP2
• Common Name: NHP2
• Gene Symbol: NHP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining