Invitrogen™ Human Nhe-1 (aa 633-722) Control Fragment Recombinant Protein

Product Code. 30206005

Brand: Invitrogen™ RP103029

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61764 (PA5-61764. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Na+/H+ antiporter (Nhe-1) is a ubiquitous membrane-bound enzyme involved in pH regulation of vertebrate cells and is specifically inhibited by the diuretic drug amiloride and activated by a variety of signals including growth factors, mitogens, neurotransmitters, and tumor promoters. Nhe-1 acts as an anchor for actin filaments to control the integrity of the cortical cytoskeleton. This occurs through a previously unrecognized structural link between Nhe-1 and the actin-binding proteins ezrin, radixin, and moesin, collectively referred to as ERM proteins. A structural role for Nhe-1 has been proposed in regulating the cortical cytoskeleton that is independent of its function as an ion exchanger. It is also thought that Nhe-1 play a role in hypertension. At least two isoforms of Nhe-1 are known to exist.

Specifications

• Accession Number: P19634
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6548
• Name: Human Nhe-1 (aa 633-722) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Apnh; APNH1; AW554487; LIKNS; Mir5122; mir-5122; Na(+)/H(+) antiporter, amiloride-sensitive; Na(+)/H(+) exchanger 1; Na+/H+ antiporter; Na+/H+, amiloride sensitive; Na-Li countertransporter; Nhe1; NHE-1; PPP1R143; protein phosphatase 1, regulatory subunit 143; SLC9A1; slow-wave epilepsy; sodium/hydrogen exchanger 1; Solute carrier family 9 (sodium/hydrogen exchanger 1), antiporter, Na+/H+, (amiloride sensitive); solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, Na+/H+, amiloride sensitive); solute carrier family 9 (sodium/hydrogen exchanger), member 1; solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Na+/H+, amiloride sensitive); solute carrier family 9 member 1; solute carrier family 9 member A1; solute carrier family 9, member 1; solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1; swe
• Common Name: Nhe-1
• Gene Symbol: SLC9A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining