missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Nhe-1 (aa 633-722) Control Fragment Recombinant Protein

Product Code. 30206005
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206005

Brand: Invitrogen™ RP103029

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61764 (PA5-61764. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Na+/H+ antiporter (Nhe-1) is a ubiquitous membrane-bound enzyme involved in pH regulation of vertebrate cells and is specifically inhibited by the diuretic drug amiloride and activated by a variety of signals including growth factors, mitogens, neurotransmitters, and tumor promoters. Nhe-1 acts as an anchor for actin filaments to control the integrity of the cortical cytoskeleton. This occurs through a previously unrecognized structural link between Nhe-1 and the actin-binding proteins ezrin, radixin, and moesin, collectively referred to as ERM proteins. A structural role for Nhe-1 has been proposed in regulating the cortical cytoskeleton that is independent of its function as an ion exchanger. It is also thought that Nhe-1 play a role in hypertension. At least two isoforms of Nhe-1 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19634
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6548
Name Human Nhe-1 (aa 633-722) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Apnh; APNH1; AW554487; LIKNS; Mir5122; mir-5122; Na(+)/H(+) antiporter, amiloride-sensitive; Na(+)/H(+) exchanger 1; Na+/H+ antiporter; Na+/H+, amiloride sensitive; Na-Li countertransporter; Nhe1; NHE-1; PPP1R143; protein phosphatase 1, regulatory subunit 143; SLC9A1; slow-wave epilepsy; sodium/hydrogen exchanger 1; Solute carrier family 9 (sodium/hydrogen exchanger 1), antiporter, Na+/H+, (amiloride sensitive); solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, Na+/H+, amiloride sensitive); solute carrier family 9 (sodium/hydrogen exchanger), member 1; solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Na+/H+, amiloride sensitive); solute carrier family 9 member 1; solute carrier family 9 member A1; solute carrier family 9, member 1; solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1; swe
Common Name Nhe-1
Gene Symbol SLC9A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.