Invitrogen™ Human NGB (aa 4-75) Control Fragment Recombinant Protein

Product Code. 30194473

Brand: Invitrogen™ RP104249

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60048 (PA5-60048. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Globins are a superfamily of gas-binding heme proteins that are present in bacteria, protists, fungi, plants and animals. Globins play evolutionarily divergent roles which include binding, transport, scavenging, detoxification, and sensing of oxygen, nitric oxide and carbon monoxide. Neuroglobin (Ngb) is a hexacoordinate hemoglobin that is predominantly expressed in the vertebrate brain and may enhance oxygen supply to neural components. Neuroglobin displays a high affinity for oxygen and its presence in cerebral neurons suggests a role in neuronal responses to hypoxia or ischemia. For example, in vitro neuronal hypoxia causes an elevation in the levels of neuroglobin, which enhances neuronal cell survival. The human neuroglobin gene maps to chromosome 14q24 and encodes a 151 amino acid protein.

Specifications

• Accession Number: Q9NPG2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 58157
• Name: Human NGB (aa 4-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Neuroglobin; NGB
• Common Name: NGB
• Gene Symbol: NGB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining