Invitrogen™ Human NFU1 (aa 91-167) Control Fragment Recombinant Protein

Product Code. 30204527

Brand: Invitrogen™ RP103938

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57413 (PA5-57413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is localized to mitochondria and plays a critical role in iron-sulfur cluster biogenesis. The encoded protein assembles and transfers 4Fe-4S clusters to target apoproteins including succinate dehydrogenase and lipoic acid synthase. Mutations in this gene are a cause of multiple mitochondrial dysfunctions syndrome-1, and pseudogenes of this gene are located on the short arms of chromosomes 1 and 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Specifications

• Accession Number: Q9UMS0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27247
• Name: Human NFU1 (aa 91-167) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610006G17Rik; CGI-33; HIRA-interacting protein 5; HIRIP; Hirip5; histone cell cycle regulation defective interacting protein 5; iron-sulfur cluster scaffold protein; mHIRIP5; MMDS1; Nfu; NFU1; NFU1 iron-sulfur cluster scaffold; NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae); NFU1 iron-sulfur cluster scaffold homolog, mitochondrial; NifU; NIFUC; NifU-like C-terminal domain containing
• Common Name: NFU1
• Gene Symbol: NFU1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining