Invitrogen™ Human NFkB p65 (aa 117-160) Control Fragment Recombinant Protein

Product Code. 30211302

Brand: Invitrogen™ RP107237

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nuclear factor kB p65 (NF-kB p65) is encoded by the RELA gene and is present on chromosome 11 in humans. NF-kB P65 is also known as RelA (v-rel avian reticuloendotheliosis viral oncogene homolog A) and belongs to the Rel family of proteins. It is one of the two subunits of NF-kB (Nuclear factor kappa-light-chain-enhancer of activated B cells) that heterodimerizes with the other subunits p50 or p52. However, binding of TNF alpha to its cognate receptor phosphorylates IKK which in turn phosphorylates I kB allowing proteasomal degradation of I kB. It specifically plays a key role in transcription of immunoglobulin k (kappa) gene in mature B-lymphoid cells.

Specifications

• Accession Number: Q04206
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5970
• Name: Human NFkB p65 (aa 117-160) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: avian reticuloendotheliosis viral (v-rel) oncogene homolog A; EBP-1; I79_021812; MGC131774; NF KB; NFkappaB p65; nf-kappa-b p65; NF-kappa-B p65delta3; NF-kappa-B transcription factor p65; NF-kappaB transcription factor p65 subunit; NFkB; NF-kB p65; NF-kB p65 subunit; nfkb rela; NFKB1; nfkb3; NFkB-p50; nuclear factor; nuclear factor kappa b; nuclear factor kappa B subunit p65; nuclear factor NF-kappa-B p65 subunit; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3; p65; p65 NF kappaB; p65 NF-kappa B; p65 NFkB; P65 transcription factor; putative transcription factor p65 homolog; REL A; rel1; rela; RELA proto-oncogene, NF-kB subunit; rela.L; rela-a; Transcription factor p65; v-rel avian reticuloendotheliosis viral oncogene homolog A; v-rel avian reticuloendotheliosis viral oncogene homolog A L homeolog; v-rel reticuloendotheliosis viral oncogene homolog A; v-rel reticuloendotheliosis viral oncogene homolog A (avian); v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65; XELAEV_18022301mg; Xrel1; xrela
• Common Name: NFkB p65
• Gene Symbol: RELA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining