Invitrogen™ Human NFkB p100 (aa 746-876) Control Fragment Recombinant Protein

Product Code. 30213184

Brand: Invitrogen™ RP102320

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82349 (PA5-82349. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q00653
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4791
• Name: Human NFkB p100 (aa 746-876) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CVID10; DNA-binding factor KBF2; H2TF1; Lymphocyte translocation chromosome 10 protein; lyt; Lyt10; LYT-10; NF kappaB2; NF-kappaB2; NF-kB p100; NFKB, p52/p100 subunit; NFKB2; NF-kB2; nuclear factor kappa B subunit 2; nuclear factor Kappa-B, subunit 2; nuclear factor NF-kappa-B p100 subunit; Nuclear factor NF-kappa-B p52 subunit; nuclear factor of Kappa light chain gene enhancer in B cells 2; nuclear factor of kappa light polypeptide gene enhancer in B cells 2, p49/p100; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2; nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100); nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, p49/p100; oncogene Lyt-10; p100; p49; p49/p100; p50B; p52; RGD1307189; transcription factor NFKB2
• Common Name: NFkB p100
• Gene Symbol: NFKB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining