missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NFATC2 (aa 29-155) Control Fragment Recombinant Protein

Product Code. 30205646
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205646

Brand: Invitrogen™ RP89309

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82364 (PA5-82364. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nuclear factor of activated T-cells (NFAT) transcription complex is required for the expression of a group of proteins that collectively regulate the immune response. Four NFAT proteins, encoded on separate genes and expressed as several splice variants, have been described: NFAT1 (also known as NFATp or NFATc2), NFAT2 (NFATc or NFATc1), NFAT3, and NFAT4 (NFATx or NFATc3). These proteins show a low level of sequence similarity with the Dorsal/Rel/NFkB family of transcription factors. Another NFAT-related protein termed NFAT5 differs from isoforms 1-4 in that it lacks many of the Fos/Jun contact sites observed in its predecessors and its subcellular localization is not calcineurin-dependent.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13469
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4773
Name Human NFATC2 (aa 29-155) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI607462; IB-IXL; KIAA0611; NFAT pre-existing s; NFAT pre-existing subunit; NFAT transcription complex, preexisting component; Nfat1; NFAT1-D; Nfatc2; NF-ATc2; Nfatp; NF-ATp; nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 2; nuclear factor of activated T-cells 2; nuclear factor of activated T-cells, cytoplasmic 2; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2; nuclear factor of activated T-cells, preexisting component; OTTHUMP00000031291; preexisting nuclear factor of activated T-cells 2; T cell transcription factor NFAT1; T-cell transcription factor NFAT1
Common Name NFATC2
Gene Symbol NFATC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.