Invitrogen™ Human NFATC2 (aa 29-155) Control Fragment Recombinant Protein

Product Code. 30205646

Brand: Invitrogen™ RP89309

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82364 (PA5-82364. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nuclear factor of activated T-cells (NFAT) transcription complex is required for the expression of a group of proteins that collectively regulate the immune response. Four NFAT proteins, encoded on separate genes and expressed as several splice variants, have been described: NFAT1 (also known as NFATp or NFATc2), NFAT2 (NFATc or NFATc1), NFAT3, and NFAT4 (NFATx or NFATc3). These proteins show a low level of sequence similarity with the Dorsal/Rel/NFkB family of transcription factors. Another NFAT-related protein termed NFAT5 differs from isoforms 1-4 in that it lacks many of the Fos/Jun contact sites observed in its predecessors and its subcellular localization is not calcineurin-dependent.

Specifications

• Accession Number: Q13469
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4773
• Name: Human NFATC2 (aa 29-155) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI607462; IB-IXL; KIAA0611; NFAT pre-existing s; NFAT pre-existing subunit; NFAT transcription complex, preexisting component; Nfat1; NFAT1-D; Nfatc2; NF-ATc2; Nfatp; NF-ATp; nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 2; nuclear factor of activated T-cells 2; nuclear factor of activated T-cells, cytoplasmic 2; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2; nuclear factor of activated T-cells, preexisting component; OTTHUMP00000031291; preexisting nuclear factor of activated T-cells 2; T cell transcription factor NFAT1; T-cell transcription factor NFAT1
• Common Name: NFATC2
• Gene Symbol: NFATC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining