Invitrogen™ Human NFAT5 (aa 173-254) Control Fragment Recombinant Protein

Product Code. 30205382

Brand: Invitrogen™ RP103975

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nuclear factor of activated T-cells (NFAT) transcription complex is required for the expression of a group of proteins that collectively regulate the immune response. Four NFAT proteins, encoded on separate genes and expressed as several splice variants, have been described: NFAT1 (also known as NFATp or NFATc2), NFAT2 (NFATc or NFATc1), NFAT3, and NFAT4 (NFATx or NFATc3). These proteins show a low level of sequence similarity with the Dorsal/Rel/NFkB family of transcription factors. Another NFAT-related protein termed NFAT5 differs from isoforms 1-4 in that it lacks many of the Fos/Jun contact sites observed in its predecessors and its subcellular localization is not calcineurin-dependent.

Specifications

• Accession Number: O94916
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10725
• Name: Human NFAT5 (aa 173-254) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI225870; B130038B15Rik; CAG-8; CAG80; glutamine rich protein H65; KIAA0827; mKIAA0827; Nfat; Nfat5; NF-AT5; NFATL1; NFAT-like protein 1; nfatz; nuclear factor of activated T cells 5; nuclear factor of activated T-cells 5; nuclear factor of activated T-cells 5, tonicity-responsive; OREBP; osmotic response element-binding protein; rel domain-containing transcription factor NFAT5; T-cell transcription factor NFAT5; TonE-binding protein; TONEBP; tonicity-responsive enhancer binding protein; tonicity-responsive enhancer-binding protein
• Common Name: NFAT5
• Gene Symbol: NFAT5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining