Invitrogen™ Human NF1 (aa 1023-1061) Control Fragment Recombinant Protein

Product Code. 30212281

Brand: Invitrogen™ RP109759

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145113 (PA5-145113. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in the gene are associated with a coagulation defect. Using positional cloning, the gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.

Specifications

• Accession Number: P21359
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4763
• Name: Human NF1 (aa 1023-1061) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW494271; DKFZp686J1293; E030030H24Rik; FLJ21220; neurofibromatosis 1; Neurofibromatosis type 1; neurofibromatosis-related protein NF-1; Neurofibromin; neurofibromin 1; Neurofibromin truncated; NF1; Nf-1; NFNS; VRNF; WSS
• Common Name: NF1
• Gene Symbol: NF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining