missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Neutrophil elastase (aa 83-133) Control Fragment Recombinant Protein

Product Code. 30212607
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212607

Brand: Invitrogen™ RP110218

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The neutrophil form of elastase is 218 amino acids long, with two asparagine-linked carbohydrate chains (see glycosylation). It is present in azurophil granules in the neutrophil cytoplasm. There appear to be two forms of neutrophil elastase, termed IIa and IIb.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P08246
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1991
Name Human Neutrophil elastase (aa 83-133) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bone marrow serine protease; ELA2; ELA2A; ELANE; Elastase; elastase 2, neutrophil; elastase, neutrophil expressed; Elastase2; elastase-2; F430011M15Rik; GE; granulocyte-derived elastase; HLE; HNE; Human leukocyte elastase; Leukocyte elastase; medullasin; NE; neutrophil elastase; PE-1; PMN elastase; PMN-E; polymorphonuclear elastase; SCN1; serine protease
Common Name Neutrophil elastase
Gene Symbol ELANE
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.