Invitrogen™ Human Neutrophil elastase (aa 83-133) Control Fragment Recombinant Protein

Produktkod. 30212607

missing translation for 'mfr': Invitrogen™ RP110218

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The neutrophil form of elastase is 218 amino acids long, with two asparagine-linked carbohydrate chains (see glycosylation). It is present in azurophil granules in the neutrophil cytoplasm. There appear to be two forms of neutrophil elastase, termed IIa and IIb.

Specifikationer

• Accession Number: P08246
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1991
• Name: Human Neutrophil elastase (aa 83-133) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bone marrow serine protease; ELA2; ELA2A; ELANE; Elastase; elastase 2, neutrophil; elastase, neutrophil expressed; Elastase2; elastase-2; F430011M15Rik; GE; granulocyte-derived elastase; HLE; HNE; Human leukocyte elastase; Leukocyte elastase; medullasin; NE; neutrophil elastase; PE-1; PMN elastase; PMN-E; polymorphonuclear elastase; SCN1; serine protease
• Common Name: Neutrophil elastase
• Gene Symbol: ELANE
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining