Invitrogen™ Human Neurotrypsin (aa 99-176) Control Fragment Recombinant Protein

Product Code. 30201256

Brand: Invitrogen™ RP102646

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57133 (PA5-57133. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neurotrypsin is a central nervous system-expressed serine protease whose truncation or absence causes nonsyndromic mental retardation. It is most prominently expressed in structures that are involved in the processing and storage of learned behavior and memory, such as the cerebral cortex, the hippocampus, and amygdala. Evidence suggests that neurotrypsin has multiple functions, including axonal outgrowth, maintaining neuronal plasticity, and arranging the perineuronal environment, partly in coordination with other proteases including tissue plasminogen activator. At least two isoforms of neurotrypsin are known to exist.

Especificaciones

• Accession Number: P56730
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8492
• Name: Human Neurotrypsin (aa 99-176) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Brain-specific serine protease 3; Bssp3; BSSP-3; leydin; Motopsin; MRT1; Neurotrypsin; Nt; peptidase, serine, 12 (neurotrypsin, motopsin); protease, serine 12; protease, serine 12 neurotrypsin (motopsin); protease, serine, 12 (neurotrypsin, motopsin); protease, serine, 12 neurotrypsin (motopsin); Prss12; Serine protease 12
• Common Name: Neurotrypsin
• Gene Symbol: PRSS12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining