missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Human Neuropeptide Y/NPY Antibody, R&D Systems™

Mouse Monoclonal Antibody
Brand: R&D Systems MAB8517-SP
This item is not returnable.
View return policy
Description
Neuropeptide Y Monoclonal specifically detects Neuropeptide Y in Human samples. It is validated for Immunohistochemistry.
Specifications
| Neuropeptide Y | |
| Monoclonal | |
| Unconjugated | |
| Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative | |
| 170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, NPY, PYY4, seprase | |
| Mouse | |
| Protein A or G purified from hybridoma culture supernatant | |
| RUO | |
| 4852 | |
| Reconstitute at 0.5 mg/mL in sterile PBS. | |
| Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. | |
| IgG2a |
| Immunohistochemistry | |
| 904032 | |
| Immunohistochemistry 8-25 ug/mL | |
| P01303 | |
| NPY | |
| Neuropeptide Y/NPY conjugated to KLH YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY Accession # P01303 | |
| 25 μg | |
| Primary | |
| Detects human Neuropeptide Y/NPY in direct ELISAs. | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction