missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194589

Invitrogen™ Human Nesprin 2 (aa 4204-4341) Control Fragment Recombinant Protein

Product Code. 30194589
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194589

Brand: Invitrogen™ RP103067

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62155 (PA5-62155. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a nuclear outer membrane protein that binds cytoplasmic F-actin. This binding tethers the nucleus to the cytoskeleton and aids in the maintenance of the structural integrity of the nucleus. Several transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WXH0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23224
Name Human Nesprin 2 (aa 4204-4341) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6820443O06Rik; AW546258; D12Ertd777e; EDMD5; KASH domain-containing protein 2; KASH2; KIAA1011; MGC96690; mKIAA1011; Nesp2; Nesp2g; nesprin 2; nesprin-2; NUA; NUANCE; nuclear envelope spectrin repeat protein 2; Nucleus and actin connecting element protein; polytrophin; Protein NUANCE; spectrin repeat containing nuclear envelope protein 2; spectrin repeat containing, nuclear envelope 2; synaptic nuclear envelope 2; synaptic nuclear envelope protein 2; synaptic nuclei expressed gene 2; SYNE2; Syne-2; TROPH
Common Name Nesprin 2
Gene Symbol SYNE2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTTPPIEADTLDSSDAQGGLEPRVEKTRPEPTEVLHACKTQVAELELWLQQANVAVEPETLNADMQQVLEQQLVGCQAMLTEIEHKVAFLLETCKDQGLGDNGATQHEAEALSLKLKTVKCNLEKVQMMLQEKHSEDQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.