Invitrogen™ Human NELL2 (aa 268-349) Control Fragment Recombinant Protein

Product Code. 30193721

Brand: Invitrogen™ RP105905

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65156 (PA5-65156. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis.This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. An alternative splice variant has been described but its full length sequence has not been determined.

Specifications

• Accession Number: Q99435
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4753
• Name: Human NELL2 (aa 268-349) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A330108N19Rik; LOW QUALITY PROTEIN: protein kinase C-binding protein NELL2; mel91; MEL91 protein; Nell2; NEL-like 2; NEL-like 2 (chicken); nel-like 2 homolog; NEL-like protein 2; Nel-related protein 2; neural EGFL like 2; neural epidermal growth factor-like 2; NRP2; Protein kinase C-binding protein NELL2; R75516
• Common Name: NELL2
• Gene Symbol: Nell2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining