Invitrogen™ Human NEK5 (aa 451-524) Control Fragment Recombinant Protein

Product Code. 30213147

Brand: Invitrogen™ RP104268

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59551 (PA5-59551. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NEK5 gene ontology (GO) annotations include positive regulation of cysteine-type endopeptidase activity; positive regulation of striated muscle cell differentiation.

Specifications

• Accession Number: Q6P3R8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 341676
• Name: Human NEK5 (aa 451-524) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6530411J22; BB049667; Nek5; Never in mitosis A-related kinase 5; NIMA (never in mitosis gene a)-related expressed kinase 5; NIMA (never in mitosis gene a)-related kinase 5; NIMA related kinase 5; NIMA-related kinase 5; nimA-related protein kinase 5; Serine/threonine-protein kinase Nek5
• Common Name: NEK5
• Gene Symbol: NEK5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining