Invitrogen™ Human NEK4 (aa 695-789) Control Fragment Recombinant Protein

Product Code. 30207351

Brand: Invitrogen™ RP108430

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111471 (PA5-111471. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NEK4 is a serine/threonine kinase involved in signal transduction and cellular communication. It is proposed to act exclusively upon threonine residues and is present in most primary carcinomas. Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The STE group (homologs of yeast Sterile 7, 11, 20 kinases) consists of 50 kinases related to the mitogen-activated protein kinase (MAPK) cascade families (Ste7/MAP2K, Ste11/MAP3K, and Ste20/MAP4K). MAP kinase cascades, consisting of a MAPK and one or more upstream regulatory kinases (MAPKKs) have been best characterized in the yeast pheromone response pathway. Pheromones bind to Ste cell surface receptors and activate yeast MAPK pathway.

Specifications

• Accession Number: P51957
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6787
• Name: Human NEK4 (aa 695-789) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Nek4; Never in mitosis A-related kinase 4; NIMA (never in mitosis gene a)-related expressed kinase 4; NIMA (never in mitosis gene a)-related kinase 4; NIMA related kinase 4; NIMA-related kinase 4; nimA-related protein kinase 4; NRK2; pp12301; serine/threonine kinase 2; serine/threonine protein kinase-2; serine/threonine-protein kinase 2; Serine/threonine-protein kinase Nek4; serine/threonine-protein kinase Nek4 variant 2; serine/threonine-protein kinase NRK2; STK2
• Common Name: NEK4
• Gene Symbol: NEK4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining