Invitrogen™ Human NEK3 (aa 391-478) Control Fragment Recombinant Protein

Product Code. 30181467

Brand: Invitrogen™ RP99574

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60284 (PA5-60284. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NIMA was originally shown in Aspergillus nidulans to be necessary for entry into mitosis. NIMA-related mammalian proteins have since been identified as Nek1, Nek2, Nek3 and Nek4 (also designated STK2 or NRK2). High expression of Nek1 is seen in male and female germ cell lines of mouse. Nek2 is the closest known mammalian relative to NIMA. Like NIMA, Nek2 expression peaks at the G2 to M phase transition. Nek3 is a predominantly cytoplasmic enzyme that was detectable in all organs studied. Levels of Nek3 seem to remain unchanged throughout the cell cycle, but appear to be elevated in G0-arrested, quiescent fibroblasts. In developing testicular germ cells, differential patterns of expression were seen for Nek1, Nek2 and Nek4, indicating possible overlapping, but non-identical functions.

Specifications

• Accession Number: P51956
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4752
• Name: Human NEK3 (aa 391-478) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: glycogen synthase A kinase; HSPK 36; HSPK36; hydroxyalkyl-protein kinase; Nek3; Never in mitosis A-related kinase 3; NIMA (never in mitosis gene a)-related expressed kinase 3; NIMA (never in mitosis gene a)-related kinase 3; NIMA related kinase 3; NIMA-related expressed kinase 3; NIMA-related kinase 3; nimA-related protein kinase 3; phosphorylase B kinase kinase; serine/threonine-protein kinase Nek3
• Common Name: NEK3
• Gene Symbol: Nek3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining