Invitrogen™ Human NEK10 (aa 338-465) Control Fragment Recombinant Protein

Product Code. 30213033

Brand: Invitrogen™ RP89824

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58601 (PA5-58601. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NEK10 (NIMA Related Kinase 10) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene includetransferase activity, transferring phosphorus-containing groupsandprotein tyrosine kinase activity.

Specifications

• Accession Number: Q6ZWH5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 152110
• Name: Human NEK10 (aa 338-465) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FLJ32685; NEK10; Never in mitosis A-related kinase 10; NIMA (never in mitosis gene a)- related kinase 10; NIMA related kinase 10; NIMA-related kinase 10; nimA-related protein kinase 10; Serine/threonine-protein kinase Nek10
• Common Name: NEK10
• Gene Symbol: NEK10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LHILQGDRNFVSDHSSIGSLSSANAAGRIQQLHLSEDLSPREIQENTFSLQAACCAALTELVLNDTNAHQVVQENGVYTIAKLILPNKQKNAAKSNLLQCYAFRALRFLFSMERNRPLFKRLFPTDLF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining