Invitrogen™ Human NEFL (aa 2-101) Control Fragment Recombinant Protein

Product Code. 30207347

Brand: Invitrogen™ RP104309

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82513 (PA5-82513. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in the maintenance of neuronal caliber, neurofilaments are the intermediate filament proteins found specifically in neurons, and are composed predominantly of three major proteins called NF-L, NF-M and NF-H. Like most other intermediate filament proteins (IFPs), the expression of the different neuronal IFPs is both tissue-specific and developmentally regulated. NF-L is the light or low molecular weight microfilament subunit and runs on SDS-PAGE gels at approximately 70 kDa. Neurofilament are the 10nm or intermediate filament proteins found specifically in neurons, and are composed predominantly of three major proteins called NF-L, NF-M and NF-H. NF-H is the heavy or high molecular weight microfilament subunit and runs on SDS-PAGE gels in the range 180-220 kDa, with some variation in different species.

Specifications

• Accession Number: P07196
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4747
• Name: Human NEFL (aa 2-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 68 kDa neurofilament protein; AI847934; CMT1F; CMT2E; FLJ53642; light molecular weight neurofilament protein; micro glutamic acid-rich protein; NEF3; Nefl; nefl.L; neurofilament; neurofilament 3; neurofilament L subunit; neurofilament light; neurofilament light polypeptide; neurofilament protein; neurofilament protein L; neurofilament protein, light chain; neurofilament subunit NF-L; neurofilament triplet L protein; neurofilament, light L homeolog; neurofilament, light polypeptide; neurofilament, light polypeptide 68 kDa; neurofilament, light polypeptide L homeolog; neurofilament-l; neurofilament-light; Nf68; NFL; NF-L; NFM; NF-M; NLC; OTTHUMP00000196614; PPP1R110; protein phosphatase 1, regulatory subunit 110; XELAEV_18018673mg; XNF-L
• Common Name: NEFL
• Gene Symbol: NEFL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining