Invitrogen™ Human Nectin 1 (aa 37-165) Control Fragment Recombinant Protein

Product Code. 30200760

Brand: Invitrogen™ RP90093

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82938 (PA5-82938. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain, and a cytoplasmic region. This protein acts as a receptor for glycoprotein D of herpes simplex viruses 1 and 2, and pseudorabies virus and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome as well as non-syndromic cleft lip with or without cleft palate. Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.

Specifications

• Accession Number: Q15223
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5818
• Name: Human Nectin 1 (aa 37-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI835281; AW549174; CD111; CLPED1; ectodermal dysplasia 4 (Margarita Island type); ED4; herpes simplex virus type 1 sensitivity; herpes virus entry mediator C; Herpesvirus entry mediator C; herpesvirus Ig-like receptor; HIgR; HV1S; Hvec; nectin 1; nectin cell adhesion molecule 1; nectin); Nectin1; nectin-1; nectin-1 alpha; nectin-1 delta; OFC7; poliovirus receptor-like 1; poliovirus receptor-related 1; poliovirus receptor-related 1 (herpesvirus entry mediator C; poliovirus receptor-related 1 (herpesvirus entry mediator C); poliovirus receptor-related 1 (herpesvirus entry mediator C; nectin); poliovirus receptor-related protein 1; PRR; PRR1; PVRL1; PVRR; PVRR1; SK-12
• Common Name: Nectin 1
• Gene Symbol: Nectin1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining