missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NECAB3 (aa 217-289) Control Fragment Recombinant Protein

Product Code. 30199530
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199530

Brand: Invitrogen™ RP108568

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84844 (PA5-84844. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96P71
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 63941
Name Human NECAB3 (aa 217-289) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900010M17Rik; AI853434; amyloid beta (A4) precursor protein-binding family A member 1 binding protein; amyloid beta (A4) precursor protein-binding, family A, member 1 binding protein; amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein; amyloid beta A4 protein-binding family A member 2-binding protein; Amyloid-beta A4 protein-binding family A member 2-binding protein; Apba2bp; dJ63M2.4; dJ63M2.5; EFCBP3; EF-hand calcium binding protein 3; mXB51; NECAB3; Nek2-interacting protein 1; neuronal calcium-binding protein 3; neuronal calcium-binding protein NECAB3; NIP1; N-terminal EF-hand calcium binding protein 3; N-terminal EF-hand calcium-binding protein 3; STIP3; synaptotagmin interacting protein 2; synaptotagmin interacting protein STIP3; SYTIP2; X11 L-binding protein 51; XB51
Common Name NECAB3
Gene Symbol NECAB3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.