Invitrogen™ Human NECAB3 (aa 217-289) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30199530	100 μL	100µL

Product Code. 30199530 Supplier Invitrogen™ Supplier No. RP108568

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84844 (PA5-84844. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q96P71
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63941
• Name: Human NECAB3 (aa 217-289) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900010M17Rik; AI853434; amyloid beta (A4) precursor protein-binding family A member 1 binding protein; amyloid beta (A4) precursor protein-binding, family A, member 1 binding protein; amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein; amyloid beta A4 protein-binding family A member 2-binding protein; Amyloid-beta A4 protein-binding family A member 2-binding protein; Apba2bp; dJ63M2.4; dJ63M2.5; EFCBP3; EF-hand calcium binding protein 3; mXB51; NECAB3; Nek2-interacting protein 1; neuronal calcium-binding protein 3; neuronal calcium-binding protein NECAB3; NIP1; N-terminal EF-hand calcium binding protein 3; N-terminal EF-hand calcium-binding protein 3; STIP3; synaptotagmin interacting protein 2; synaptotagmin interacting protein STIP3; SYTIP2; X11 L-binding protein 51; XB51
• Common Name: NECAB3
• Gene Symbol: NECAB3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining